Protein Info for DVU2646 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: 1-aminocyclopropane-1-carboxylate deaminase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01275: pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family
  • amino acids 12 to 329 (318 residues), 298.5 bits, E=3.3e-93
• PF00291: PALP
  • amino acids 15 to 319 (305 residues), 187.9 bits, E=1.4e-59

Best Hits

KEGG orthology group: K05396, D-cysteine desulfhydrase [EC: 4.4.1.15] (inferred from 100% identity to dvl:Dvul_0604)

Predicted SEED Role

"pyridoxal phosphate-dependent deaminase, putative"

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-serine degradation (3/3 steps found)
• L-tryptophan degradation II (via pyruvate) (3/3 steps found)
• D-serine degradation (2/3 steps found)
• L-cysteine degradation II (2/3 steps found)
• L-methionine biosynthesis II (4/6 steps found)
• glycine betaine degradation III (4/7 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (2/8 steps found)

KEGG Metabolic Maps

• Cysteine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.15

Sequence Analysis Tools

See Q728F7 at UniProt or InterPro

Protein Sequence (332 amino acids)

>DVU2646 1-aminocyclopropane-1-carboxylate deaminase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNLAVFPRRGYVKDPTPIESCPAFSKALGGKVNIFIKRDDLLPGCAGGNKTRKLDFCMAD
ALAKGADTIITCGAVQSNHCRLTLSWAVKEGLDCHLVLEERVKGSYKPEASGNNFLFKLM
GVKSITVVPGGSNMMGEMEALAARLKEAGRTPYIIPGGASNPIGATGYVSCAQETLQQLF
DMGLKVDHMVVPSGSAGTHAGIVVGMVGNNANIPVSGINVSRTKADQEALVRKLARETAQ
RVGMSGEFPDEAVTCFDGYVGPGYSLPTESMVEAVRLLAQTEGILLDPVYSGKAMAGLVD
LVRSGYFAEGSNVLFLHTGGSPALYAYLDTFK