Protein Info for DVU2645 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: Na+/H+ antiporter family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 388 to 412 (25 residues), see Phobius details amino acids 432 to 451 (20 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 72 to 214 (143 residues), 61.7 bits, see alignment E=3.7e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2645)

Predicted SEED Role

"Na+/H+ antiporter family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728F8 at UniProt or InterPro

Protein Sequence (466 amino acids)

>DVU2645 Na+/H+ antiporter family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEKRLEMHGGILGGLVPLITLVGGLVWLSVAERGGTKPFWACAWIAITLGLFFARNKADY
CKAAMRGIGDKTGIVIVTAWLFAGVFGKLMVAGGLVDGLLWMGMTTGAQGAVFTLMVFVA
AMLFALGTGTSTGTCIALTPVLYPAGHFLGADPAMLGLAILSGAAFGDNLAPISDTTIVS
AYTQGATMRDVVRSRFPLAMAAATIAAGVFLVFGGGGALQPLPEIQARMNPLGAFMLLAL
VVVVAAALSGRHIIESLIYGNVSAAVIGMVTGNLTLQTLFSIPAKRGISTGIIEDGINSV
VGAIIFAILILAVTQILVETGIMKRILNAAEGAIVRSVRQAEFFIIGVTVVASVPISANA
PAELLVGPSLVRPVGEKFDLAPARRANLMDCAVCTVFFMLPWHIVVAAWYAAVVSAGEAY
GISVPPISAALYNPYSWALLAVLVFSAYTGWNRKLGGNAEPLSEAA