Protein Info for DVU2638 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2638)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728G5 at UniProt or InterPro

Protein Sequence (362 amino acids)

>DVU2638 conserved domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGFMRVSQDSAGVMRLVPGPEYKAAPGMALLLSSMCLAGAGLVMGEDALGGVFLLVASLM
LLLVVGLLRARMRDVVFDAIEGAVYLLGRRRADVAQVPLCEVAALRTMRVGRGGRHCELA
LVLCDGGWIGLDRGSRQEPLTRLGESLAAHMGLPFEAGGGPSSGTPPGKTAAAGGEAVGD
GTVAACPGVPREPSPGSALAQDARGRSWQWSVSPGGAALGLMAFVSGALLCVVGYGLSLM
LAGGFVEGLVMVFVGGFFTYVVMGRLLRGVFGGGWLAVRGRLLQAGERLFDRKHTLWERE
FDDVEGFRVAMPILGPSRLECLTTQGEVLPVIVVTPGLSAVTPGDVLWLAARLRQMAARR
DA