Protein Info for DVU2637 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: HAMP domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 254 to 278 (25 residues), see Phobius details PF08269: dCache_2" amino acids 6 to 242 (237 residues), 149.4 bits, see alignment E=4e-47 PF17200: sCache_2" amino acids 18 to 140 (123 residues), 83.8 bits, see alignment E=3.9e-27 amino acids 146 to 247 (102 residues), 63.7 bits, see alignment E=6.1e-21 PF17201: Cache_3-Cache_2" amino acids 38 to 140 (103 residues), 65.5 bits, see alignment E=1.6e-21 amino acids 144 to 250 (107 residues), 75.7 bits, see alignment E=1.2e-24 PF00672: HAMP" amino acids 276 to 322 (47 residues), 41.4 bits, see alignment 4.3e-14 TIGR00229: PAS domain S-box protein" amino acids 361 to 475 (115 residues), 24.2 bits, see alignment E=1.5e-09 PF08448: PAS_4" amino acids 371 to 477 (107 residues), 24.7 bits, see alignment E=7e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0613)

Predicted SEED Role

"HAMP domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728G6 at UniProt or InterPro

Protein Sequence (487 amino acids)

>DVU2637 HAMP domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
VRLAADLSVTSYLRAVSEKALDIVSTYGALARTGRMSEEEAKAQAARMLLALRVGTSGYV
YVIGSTGVMQVHPQVPLVGQNLSNYTFVQEQLRRQSGYIQYEWRNPGESRRRPKALYMVR
YEPWDWIISASAYRDEFRDLVDINAFKDTVLSFRIGETGYAYMLTGGGELLIHPWRDEHT
GQDWRDGSGRRFVQEMLERREGRIRYTWKNPGDGSFREKVAAFTYMPEYDWIVVASGYMD
ELQAPVLELRNVTMVAVTGGGVMLALLGWWCVAAALGPLRRLAHAVRRGAEGDLAVRFVP
EGQDEVGRLADDFNRLMGNLEAHTSRLEDRVQERTLELTRLNAAYREEIDMRREVEGKAR
HRLEFLRSLMNAVPCPIFFRNREGAFIDCNDNFAELVLGVDIAEVAGKRPEDFPGVYLPI
YLEEMRRGEELLWRDGGVQSMDVRIVCGDGLERRFRVSKRPFVSSEGEEGLLGVMVELPP
CDAEERA