Protein Info for DVU2617 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sodium/calcium exchanger family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 315 to 332 (18 residues), see Phobius details amino acids 339 to 357 (19 residues), see Phobius details amino acids 374 to 392 (19 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 33 to 178 (146 residues), 50.5 bits, see alignment E=1.1e-17 amino acids 209 to 350 (142 residues), 56.4 bits, see alignment E=1.7e-19

Best Hits

KEGG orthology group: K07301, inner membrane protein (inferred from 100% identity to dvu:DVU2617)

Predicted SEED Role

"sodium/calcium exchanger family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728I6 at UniProt or InterPro

Protein Sequence (406 amino acids)

>DVU2617 sodium/calcium exchanger family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTFRESVPFIVAIAATIPGILLRVVHPDISPLLMASLTGLAILGASFMLMWACEVAQMDI
PQTLALAVVALIAVLPEYAVDMYFTWMAGQHPESNYAHYAIANMTGANRLLIGIGWSAIA
ILYALRFRKAVQLEEERRSELLFLALATAYALVIPLKGTLEWYDGVILVSLYVWYIRIAS
KRPCTDCEVEGPAEALAHLPRNTRRLTTLGLFLFAAGVILCDAELFSESLVASGKVLGIN
EFLLVQWLAPIASEAPEFIVAIMFATRGQASLALGSLISSKLNQWTLLVGMIPGVFAVSS
GSINPPMPMDDHQMHELLLTAAQSLFAVVLLARMRLGLRGALVLLALFIGQFAAPLYEPY
VENLLGIPHMPDGLHIVYSGLYIALALGMMLYRPGRLLQLREGLKV