Protein Info for DVU2579 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: TPR domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details PF14559: TPR_19" amino acids 78 to 125 (48 residues), 26.7 bits, see alignment 3.5e-09 PF13432: TPR_16" amino acids 78 to 123 (46 residues), 23.2 bits, see alignment 4.8e-08 amino acids 95 to 155 (61 residues), 24.6 bits, see alignment E=1.7e-08 PF00515: TPR_1" amino acids 89 to 122 (34 residues), 30 bits, see alignment 2e-10 PF07719: TPR_2" amino acids 89 to 122 (34 residues), 27.4 bits, see alignment 1.4e-09 PF13181: TPR_8" amino acids 89 to 122 (34 residues), 23.9 bits, see alignment 2e-08 amino acids 138 to 156 (19 residues), 12.7 bits, see alignment (E = 7.6e-05) PF12895: ANAPC3" amino acids 101 to 180 (80 residues), 27.8 bits, see alignment E=1.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2579)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmH" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728M4 at UniProt or InterPro

Protein Sequence (209 amino acids)

>DVU2579 TPR domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPAKATQASETPEGFVRKSTFYMAVAVALVAGLYLGNVLTSTLAPGQSPVTKKQVSAPSG
EQATSQVPPEVMNRILELEQAVIKNPQDADAWTHLGHLYFDTHQAKEAIRAYERSLALKP
NDPDVITDLGVMFRADHQHDKALAAFDKAVSINPKHEIALFNKGIVLYFDMEKKDEGLAV
WRKLLSTNPAAKAPDGTPLDAMIKQLSAK