Protein Info for DVU2575 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: peptidase, M20/M25/M40 family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF01546: Peptidase_M20" amino acids 68 to 360 (293 residues), 65.6 bits, see alignment E=6.3e-22 PF07687: M20_dimer" amino acids 172 to 277 (106 residues), 51.2 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0672)

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728M8 at UniProt or InterPro

Protein Sequence (366 amino acids)

>DVU2575 peptidase, M20/M25/M40 family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSLEDILALTSALIRYRSTDTRPEERDRCAAHIMRWCDAEDIASSRVDNNGVTSLIIGP
ASKRAPLLFMAHYDVVEGPDALFQPVLSDSVLKGRGSIDDKYAVALSLVLFRDHLRHLRA
QGRSQDDMPLQLLITGDEETGGYDGARHALGHVGAEFCIALDGGSPSTVITKEKGIIDCT
LTAHGRAAHGARPWLGTNAVECLMADYMALKRLFPGQDDPTDPIHWHRSLNLGIVRAGSA
VNQVPDLATAWLDVRYTEHDDPQALFAAMQESIRGELVATRTEPVFHSGETPWIDRLLAC
APGASTGFAHGASDARFLSEHGIPGVVWGAEGETSQHGPDEHLLVDSLDTVHKALAAFVR
TAGGTA