Protein Info for DVU2565 in Desulfovibrio vulgaris Hildenborough JW710

Name: bioD
Annotation: dethiobiotin synthetase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13500: AAA_26
  • amino acids 17 to 226 (210 residues), 133.2 bits, E=5.6e-43
• TIGR00347: dethiobiotin synthase
  • amino acids 18 to 186 (169 residues), 132.8 bits, E=6.3e-43

Best Hits

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 100% identity to dvu:DVU2565)

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

• biotin biosynthesis I (13/15 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (4/4 steps found)
• biotin biosynthesis II (5/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.3

Sequence Analysis Tools

See Q728N8 at UniProt or InterPro

Protein Sequence (246 amino acids)

>DVU2565 dethiobiotin synthetase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSAHEMNHATPRLPAPLFVTGTDTGVGKTVVSLLLMRALFRRGMVPFYAKPMQTGCRDPY
DTDSDAAFVYRHVPELAERDPAEAVGWCFRAPKAPLHAARDERNGVETEDLMRRLAILRA
THACLVLEGAGGLMVPFTADALCVDCIRAADARPVLVARDGLGTVNHTLLSVEAMTRRGV
TPAGIVFVASGKRPTPSDLVHDNMEAVAMLSGISVSGIVPPILDFHAPPEAALTVADAVI
DAALGL