Protein Info for DVU2560 in Desulfovibrio vulgaris Hildenborough JW710
Annotation: conserved domain protein (TIGR)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.
Best Hits
KEGG orthology group: K02372, 3R-hydroxymyristoyl ACP dehydrase [EC: 4.2.1.-] (inferred from 100% identity to dvu:DVU2560)Predicted SEED Role
"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)
MetaCyc Pathways
- ammonia assimilation cycle III (3/3 steps found)
- L-glutamate biosynthesis I (2/2 steps found)
- L-glutamine degradation I (1/1 steps found)
- L-glutamine degradation II (1/1 steps found)
- L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
- glutaminyl-tRNAgln biosynthesis via transamidation (3/4 steps found)
- L-citrulline biosynthesis (5/8 steps found)
- L-glutamate and L-glutamine biosynthesis (4/7 steps found)
- superpathway of L-citrulline metabolism (7/12 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Fatty acid biosynthesis
- Glutamate metabolism
- Limonene and pinene degradation
- Nitrogen metabolism
- Nucleotide sugars metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Porphyrin and chlorophyll metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.4.1.13, 4.2.1.-
Use Curated BLAST to search for 1.4.1.13 or 4.2.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q728P3 at UniProt or InterPro
Protein Sequence (128 amino acids)
>DVU2560 conserved domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710) MKTVHEGTFLFPATHPLFADHFEGAPVVPGSLLLRAFVEEAGTVWPDFATQGATGFRFRR FVTPGRHPFRMERTDLTVRCTLMDAQGGILVRGDLTTADATGDAGTDNDRTGADGEAALH TSPRGTTA