Protein Info for DVU2558 in Desulfovibrio vulgaris Hildenborough JW710

Name: bioB
Annotation: biotin synthase (Dmitry Rodionov)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 TIGR00433: biotin synthase" amino acids 15 to 308 (294 residues), 362.9 bits, see alignment E=6.5e-113 PF04055: Radical_SAM" amino acids 51 to 206 (156 residues), 71.6 bits, see alignment E=9.2e-24 PF06968: BATS" amino acids 219 to 308 (90 residues), 87.2 bits, see alignment E=7e-29

Best Hits

Swiss-Prot: 100% identical to BIOB_DESVH: Biotin synthase (bioB) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 100% identity to dvl:Dvul_0690)

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.6

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728P5 at UniProt or InterPro

Protein Sequence (310 amino acids)

>DVU2558 biotin synthase (Dmitry Rodionov) (Desulfovibrio vulgaris Hildenborough JW710)
MPEGITVEEALAVAELPQKHALDILATAQAIRSVHKGGPAALCGIVNAKSGRCPEDCAFC
AQSSHHATGSPVHALLDAETLLRRAEELRQSGAERYGIVTSGTRLTVRELATLCEAAVRI
RRETGIALCGSLGQLTPDAAACLKEAGFSSYHHNLETSRSFFPAICSTHAYDDDIATVRA
ARAAGLRTCSGGIFGMGETDAQRIELSATLRELDVDSIPVNLLSPIPGTPLQHRPTMPPM
RALVSIAIYRLMHPARDILVCGGREATLGPWQSWIFLAGANGMMVGNYLTTTGRDMADDL
AMLATLGVRA