Protein Info for DVU2552 in Desulfovibrio vulgaris Hildenborough JW710

Name: gltX-2
Annotation: glutamyl-tRNA synthetase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 TIGR00464: glutamate--tRNA ligase" amino acids 4 to 459 (456 residues), 545.7 bits, see alignment E=5.2e-168 PF00749: tRNA-synt_1c" amino acids 4 to 304 (301 residues), 351.1 bits, see alignment E=4.7e-109 PF19269: Anticodon_2" amino acids 317 to 460 (144 residues), 111.5 bits, see alignment E=4.6e-36

Best Hits

Swiss-Prot: 100% identical to SYE_DESVH: Glutamate--tRNA ligase (gltX) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 100% identity to dvl:Dvul_0696)

Predicted SEED Role

"Glutamyl-tRNA synthetase (EC 6.1.1.17)" in subsystem Heme and Siroheme Biosynthesis or tRNA aminoacylation, Glu and Gln (EC 6.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.17

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728Q1 at UniProt or InterPro

Protein Sequence (463 amino acids)

>DVU2552 glutamyl-tRNA synthetase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSNVVTRFAPSPTGHLHIGGARTAIFNWLLARHFGGRFVLRIEDTDTERSKQEYTDSILA
SMKWLGLDWDGDLIYQSERFDIYNSYIDRLLESGHAYWCECPPDEVEKMREEARAKGLKP
RYNGRCRSRDLGPGDGRVVRLKAPAEGRIVFDDLVKGTVAFDVAELDDMVLRRSDGAPTY
NLAVVVDDATMGVTHVLRGDDHLSNTPKQILLYQALGFDLPRFGHVPMILGPDRKKLSKR
HGAKAVIEYEQYGLLPQALVNYLVRLGWSHGDQEIFALEELVEKFGTENLNSSAAGFDPD
KLEWLNGHYLRETSPEELARLVLPFVAAEGFDVDASRLAQLVPLFRERANNLVELARVMR
FMLVPAAEVEYDAAAVAKALTEEGRRHVAGVREALAALGTFDREGCEKAIHDYVEGNGLK
FKQVAPAVRVAVVGAMGGPGLPDMMALLGRDDVLARLDRAVAL