Protein Info for DVU2548 in Desulfovibrio vulgaris Hildenborough JW710

Name: acpD
Annotation: acyl carrier protein phosphodiesterase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF03358: FMN_red" amino acids 3 to 126 (124 residues), 29.6 bits, see alignment E=4.7e-11 PF02525: Flavodoxin_2" amino acids 3 to 204 (202 residues), 166.3 bits, see alignment E=7.1e-53

Best Hits

Swiss-Prot: 100% identical to AZOR_DESVH: FMN-dependent NADH-azoreductase (azoR) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 100% identity to dvl:Dvul_0699)

Predicted SEED Role

"FMN-dependent NADH-azoreductase (EC 1.7.-.-)" (EC 1.7.-.-)

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728Q5 at UniProt or InterPro

Protein Sequence (209 amino acids)

>DVU2548 acyl carrier protein phosphodiesterase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MATILYIKASPRGERSHSVTVADAFVKAYSEANPGDVVRVLDVFEADLPAFGTDAVVARY
LSGQGDPLSPAQEAAWAAVKRQVEDFKTADKYVIALPMWNFSIPWRLKQFFDIIIQPGLT
FSYDEQGYHGLVTGRPVLVSYARGGAYPAGTPAEGWDFQKRYLEHILGFIGFTDIRSVVV
EPTLAGGPDTAQAKRAEAVEQARRMALEF