Protein Info for DVU2546 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 PF13188: PAS_8" amino acids 37 to 95 (59 residues), 27 bits, see alignment 9.7e-10 amino acids 150 to 204 (55 residues), 27.5 bits, see alignment 6.4e-10 TIGR00229: PAS domain S-box protein" amino acids 147 to 270 (124 residues), 48.9 bits, see alignment E=3.6e-17 PF00989: PAS" amino acids 151 to 262 (112 residues), 26 bits, see alignment E=2.4e-09 PF08448: PAS_4" amino acids 156 to 267 (112 residues), 41.5 bits, see alignment E=4.2e-14 PF13426: PAS_9" amino acids 160 to 264 (105 residues), 47.6 bits, see alignment E=5.5e-16 PF02518: HATPase_c" amino acids 420 to 535 (116 residues), 87.4 bits, see alignment E=2.7e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0701)

Predicted SEED Role

"sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728Q7 at UniProt or InterPro

Protein Sequence (540 amino acids)

>DVU2546 sensory box histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQKPSRDDIRKQLIGFGEDSVRKSYYPELRRNLQQVERFRALLESSGDAIFTLDAATGIV
MDCNHSAQRLAERDTLEGIALGDILPGIPAPPFSGTQRLELTKEVAGWKMHLDVMLEPQP
IDGGRYASCIVRDVTRRVRAERELADTLATYRSLYDSVMDAIIVIDGARIADCNNIAERL
FGLHRGKLIGRSIHEMSPPLQPDGRPSPQMALQHIEAAIRGRSHRFDWVHIGAEGVPFRA
EVSLSPLKHETHDYCIAVIRDVTEQHRMRELMIQTEKMHSVGGVAAGMAHEINNPLSAIA
QAAQNIERRLATDLAGNIKAASVTGMDLEALRNYLEARGVPMLLGHIRDACARAATIVRN
MLDFSRRSDSSRTTCDIEAIIRKALALADNDYDLRKHHDFRSIHISFDCPDDLPTITCVP
TELEQVIFNLLKNASEAFADIDATDRREDPAIHIAVTTEESYDGLRLAISDNGPGMHEAL
RRRVFEPFFTTKPPGKGTGLGLSVSYFIITQNHGGEMWVESQPGAGTTFVIRLPSACAGA