Protein Info for DVU2543 in Desulfovibrio vulgaris Hildenborough JW710

Name: b0873
Annotation: hybrid cluster protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 TIGR01703: hydroxylamine reductase" amino acids 30 to 565 (536 residues), 758.8 bits, see alignment E=1.4e-232 PF03063: Prismane" amino acids 30 to 562 (533 residues), 560 bits, see alignment E=2.6e-172

Best Hits

Swiss-Prot: 70% identical to HCP_DESMR: Hydroxylamine reductase (hcp) from Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)

KEGG orthology group: K00378, hydroxylamine reductase [EC: 1.7.-.-] (inferred from 100% identity to dvu:DVU2543)

Predicted SEED Role

"Hydroxylamine reductase (EC 1.7.-.-)" in subsystem Nitrosative stress (EC 1.7.-.-)

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728R0 at UniProt or InterPro

Protein Sequence (566 amino acids)

>DVU2543 hybrid cluster protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MVFDRIISFFTGRQEAPVNNIQPREAHMSMFCNQCEQTAKGTGCTTIGVCGKQPEVSALQ
DLTIYALRGLSLVALAAREKGIIDAKIDEYTAKALFTTLTNVNFDPARFDVYVREIVAHR
KALAARAGVDFSEGPAAFEPASTLDGLVAQAEIGSVTAGAEDADIRSLKQILLYGMKGVA
AYVDHAAILGQTDAAVFGFLHKGLAAGYDGVARDLGAWIELAMECGRANLRAMELLDAGN
TTTYGHPVPTQVPLGHRKGKCILVSGHDLKDLFELLKQTEGKGIDIYTHGEMLPTHAYPE
LKKFPHFYGHFGTAWQNQHKEFPAFPGAILFTTNCIQKPQASYAANVFTTGLVGWPGLVH
CENHDFTPVINKALELPGFTDDVPGKTVTVGFGRNTVMSVAPAVIDAVKSGAIRHFFLVG
GCDGAKPGRNYYTEFVEKTPADTVVLTLACGKFRFFDKDLGTIGGIPRLLDVGQCNDAYS
AIKIASALAEAFNCGVNDLPLSLVLSWYEQKAVAILLTLLAIGIKDIRLGPSLPAFVTPN
VLKFLVDNFNIKPISTADEDLKAILG