Protein Info for DVU2540 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: lyase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF06050: HGD-D" amino acids 35 to 378 (344 residues), 387.6 bits, see alignment E=3.6e-120

Best Hits

Swiss-Prot: 46% identical to YJIM_ECOLI: Putative dehydratase subunit YjiM (yjiM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0706)

Predicted SEED Role

"2-hydroxyglutaryl-CoA dehydratase, D-component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728R3 at UniProt or InterPro

Protein Sequence (380 amino acids)

>DVU2540 lyase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSFASIDRLKDAAERNALAINEAKAAGRKVVGLYCLYSPAEIAIAAGAIPVVLCGTRQDP
IAAAERTLPRNLCPLIKSSFGFAVEGSCPYLGAADLVVADTTCDGKKKMFELLGEMKPVH
MLQLPHEQGPRALDYWRDELEALVRRMEADFGVTVTDDDLRGAIATMNRERRALKALMDL
PRLNPSPVSGMTMLEMLFKLGFFSDRETIIRLAEDVVAEVHAAADAGALPERPRVPRILL
TGVPVGMGSHKVVRLIEECGADVVCMENCTGYKKTLMVDEQGDPLTELARRYLATPCSVM
TPNTGRFTMLADIARDFAVDGVVDLTWQACHTYNVEAHKVRSFFRETFDLPVLHIETDYS
ESDAEQLKVRIEAYLEMLGR