Protein Info for DVU2537 in Desulfovibrio vulgaris Hildenborough JW710

Name: infC
Annotation: translation initiation factor IF-3 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 TIGR00168: translation initiation factor IF-3" amino acids 13 to 172 (160 residues), 224.7 bits, see alignment E=2.6e-71 PF05198: IF3_N" amino acids 13 to 81 (69 residues), 121.6 bits, see alignment E=1.2e-39 PF00707: IF3_C" amino acids 88 to 172 (85 residues), 122.1 bits, see alignment E=7.3e-40

Best Hits

Swiss-Prot: 100% identical to IF3_DESVH: Translation initiation factor IF-3 (infC) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 100% identity to dvl:Dvul_0708)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728R6 at UniProt or InterPro

Protein Sequence (176 amino acids)

>DVU2537 translation initiation factor IF-3 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRRDVPQDSVRRNEQIRAREVRLIGAEGEQLGIISRNDAIALAKEKGLDLVEVAATADPP
VCRVMDYGKYKYEQQKKKQEAKKRQTVVQIKEIKVRPKTDEHDYQTKLKHVRRFLEEGDR
CKVTVFFRGREIVHKDRGLTILDRFVEDTKDLAKLDQEARAEGRTLQMMLAPIPKK