Protein Info for DVU2537 in Desulfovibrio vulgaris Hildenborough JW710
Name: infC
Annotation: translation initiation factor IF-3 (TIGR)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to IF3_DESVH: Translation initiation factor IF-3 (infC) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)
KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 100% identity to dvl:Dvul_0708)Predicted SEED Role
"Translation initiation factor 3"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q728R6 at UniProt or InterPro
Protein Sequence (176 amino acids)
>DVU2537 translation initiation factor IF-3 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710) MRRDVPQDSVRRNEQIRAREVRLIGAEGEQLGIISRNDAIALAKEKGLDLVEVAATADPP VCRVMDYGKYKYEQQKKKQEAKKRQTVVQIKEIKVRPKTDEHDYQTKLKHVRRFLEEGDR CKVTVFFRGREIVHKDRGLTILDRFVEDTKDLAKLDQEARAEGRTLQMMLAPIPKK