Protein Info for DVU2521 in Desulfovibrio vulgaris Hildenborough JW710

Name: aroK-2
Annotation: shikimate kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF13671: AAA_33" amino acids 18 to 128 (111 residues), 28.8 bits, see alignment E=1.4e-10 PF01202: SKI" amino acids 23 to 175 (153 residues), 111.2 bits, see alignment E=5.6e-36

Best Hits

Swiss-Prot: 33% identical to AROK_HAEDU: Shikimate kinase (aroK) from Haemophilus ducreyi (strain 35000HP / ATCC 700724)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 100% identity to dvl:Dvul_0723)

MetaCyc: 75% identical to homoserine kinase (Desulfovibrio vulgaris)
Homoserine kinase. [EC: 2.7.1.39]

Predicted SEED Role

"Shikimate kinase I (EC 2.7.1.71)" in subsystem Benzoate transport and degradation cluster or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.71

Use Curated BLAST to search for 2.7.1.39 or 2.7.1.71

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728T1 at UniProt or InterPro

Protein Sequence (180 amino acids)

>DVU2521 shikimate kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MMTRREGARLFEGCCVTIIGMAGAGKTTVGRELARQMDWAHVDTDSLIEATYGTVLQNVA
DSMSKEAFLDVEAGIICRIGAKRAVLSTGGSVVYRAEAMRHLASLGPVVYLDVSLPLILE
RIARNPDRGLAIAPGQTIEDLYNERKALYETYQDFTLTADTLTPEECGRAILSWLETADA