Protein Info for DVU2515 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: HD domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 162 to 179 (18 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details PF01966: HD" amino acids 165 to 289 (125 residues), 49.4 bits, see alignment E=5.5e-17 PF13487: HD_5" amino acids 188 to 317 (130 residues), 93.5 bits, see alignment E=1.4e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0730)

Predicted SEED Role

"HD-GYP domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728T7 at UniProt or InterPro

Protein Sequence (351 amino acids)

>DVU2515 HD domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MCAVKSPIPDNISEEYYQISAAILSSFPKYRPPVDLFRFRDDIAQLTPYSRKGQRLSNEQ
VEEVARLCDEGDLFVSRTDHPIYSQHIVKQLDLILVDRNLKESEVADICLRALALRFSDF
ADQPVRPVFETLYKDMMVFTEYLWQDRHRIKLFMRRLFREHTLAQHSLNTLAVGLWLFIN
SMGDGLKRRDLDRAALGFLLHDLGMARIPAFILSKTTPLKPEERDKIPLHPLSGIKTMHK
LGLAFDEMRQAVLEHHERLDGSGYPQKLKGEQVSRIGRIAAVADSFSAMIAQRPHAPAKE
PLVAAQELAADRNRYDTRYTSQLLTAFMTGAFSREGAATTALVLEAQPTRS