Protein Info for DVU2514 in Desulfovibrio vulgaris Hildenborough JW710

Name: pyk
Annotation: pyruvate kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01064: pyruvate kinase
  • amino acids 2 to 429 (428 residues), 455.5 bits, E=8.8e-141
• PF00224: PK
  • amino acids 2 to 323 (322 residues), 354.1 bits, E=7.3e-110
• PF02887: PK_C
  • amino acids 356 to 466 (111 residues), 76.9 bits, E=1.3e-25

Best Hits

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 100% identity to dvl:Dvul_0731)

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• homolactic fermentation (11/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• Bifidobacterium shunt (13/15 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis IV (8/10 steps found)
• mixed acid fermentation (12/16 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• heterolactic fermentation (13/18 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• Entner-Doudoroff pathway I (6/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (18/26 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (14/22 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (4/9 steps found)
• glycerol degradation to butanol (9/16 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (15/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (6/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.40

Sequence Analysis Tools

See Q728T8 at UniProt or InterPro

Protein Sequence (469 amino acids)

>DVU2514 pyruvate kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRTKIIATIGPASRSHEVLSRLVNAGVGIFRLNFSHGDASMFVELIGLLRELERESGRPL
TILQDLSGPKIRIGEIAKGALSVSKGDRLLLGPAPAPADNRPFIPFDHPAVLAEFEIGDR
VVLSDGGLQFRVVDKGPNGTFELEANNNGMITSRKGLALPGKSVKLAALTAKDRKDLADG
LALGVDAVALSYVQTPDDIRDAKEIIRAAGRNIPVIAKLERQNAVDRLDEILAETDIVMV
ARGDLGVECPLPELPAMQKRIIRACNRAAKPVIVATQMLLSMVNSPSPTRAETTDVANAV
LDGADCVMLSEETAMGSFPVETVNFMKEIAMKAEELHFELQRLREPDVGRGSADFLAYSA
CLLAEKANADAIVSHSLSGSSARLISSRRPQQPVYAITPDPAAQRWLNFSWGVFPEGGDE
GISGHLERAEAFIERCPDIPDGADVVITAGQPKPGDTPRGTNLVKIYRK