Protein Info for DVU2506 in Desulfovibrio vulgaris Hildenborough JW710

Name: murD
Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 PF21799: MurD-like_N" amino acids 17 to 91 (75 residues), 36.8 bits, see alignment E=5.9e-13 TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 18 to 430 (413 residues), 369.4 bits, see alignment E=1.5e-114 PF08245: Mur_ligase_M" amino acids 123 to 228 (106 residues), 85.2 bits, see alignment E=9.4e-28 PF02875: Mur_ligase_C" amino acids 296 to 363 (68 residues), 28 bits, see alignment E=3.3e-10

Best Hits

Swiss-Prot: 100% identical to MURD_DESVV: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to dvu:DVU2506)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728U6 at UniProt or InterPro

Protein Sequence (433 amino acids)

>DVU2506 UDP-N-acetylmuramoylalanine--D-glutamate ligase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTCDKEKTRGIRPGDIAVVVGTGRSGVAAARLLHAKGARVRVLERDAANVPATFAEWAAG
AGVEIVCGAHDAAHFADAAVVVPSPGVAVATLRPYLPATGGPEVMAEMELAWRELSGEPV
IAVTGTSGKTTTVSLCAHMLRTQGLSVFLGGNIGTPLCEYVLEGKRADVLVIEISSFQLQ
TCSTFRPRVAMLLNITANHLDYHADMQEYIDAKFRLFRCQDEDDLAVFGEGLAPLVDRYG
VKARRVTFRATDRFAESRLFGAHNRANAEAAWTAAREFGVTLENALQAVATFAPMPHRLE
QVAERGGVLYVNDSKCTTVSALRVALEAFDRPVLLLAGGKFKGGDLEGLIPLVRERVRAV
MLFGASREVFEAAWRDVVPMTWDATLEEAVRRAASAARQGEVVLMAPATASFDLFRNYGH
RGDVFRAAVESLA