Protein Info for DVU2494 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: peptidase, M48 family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 48 (18 residues), see Phobius details amino acids 144 to 169 (26 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details PF01435: Peptidase_M48" amino acids 65 to 281 (217 residues), 130.1 bits, see alignment E=4.3e-42

Best Hits

Swiss-Prot: 59% identical to HTPX_GEOUR: Protease HtpX homolog (htpX) from Geobacter uraniireducens (strain Rf4)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 100% identity to dvl:Dvul_0750)

Predicted SEED Role

"Peptidase M48, Ste24p precursor"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728V8 at UniProt or InterPro

Protein Sequence (286 amino acids)

>DVU2494 peptidase, M48 family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTSQIKTAMLLALLSAMIILLGGAMGGKTGIVIAFGLALVMNVGSYWYSDKIVLSMYRAQ
EVSPADAPMLHAMVDELAAKAGIPKPRVCIIPEEAPNAFATGRDPAHGVVAVTQGIMRIL
SPEELKGVLAHEIGHIANRDILIQTVASVMASAIVSIANMMQWAAIFGFGRSDDEEGGTN
PLVAILLAIVAPIAASLIQFAISRSREYLADDAGAQYAGNPLYLANALQKLDAWSKRIPM
QSANMATESMFIVSPLTGGGISSLFSTHPPIEERVSRLQAMAAGRR