Protein Info for DVU2479 in Desulfovibrio vulgaris Hildenborough JW710

Name: pstA-2
Annotation: phosphate ABC transporter, permease protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 37 to 64 (28 residues), see Phobius details amino acids 84 to 114 (31 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 202 to 243 (42 residues), see Phobius details amino acids 250 to 266 (17 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 35 to 305 (271 residues), 281 bits, see alignment E=4.2e-88 PF00528: BPD_transp_1" amino acids 106 to 309 (204 residues), 61 bits, see alignment E=6.5e-21

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 99% identity to dvl:Dvul_0763)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728X3 at UniProt or InterPro

Protein Sequence (309 amino acids)

>DVU2479 phosphate ABC transporter, permease protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPRTAFASQQTATLGNIGHMPQDSGYVKRRKPLQRFMFGLFHVAVFINAAALAIICGFVL
YHGLPAISWEFLTAFPRDSMTKGGILPCILGTIALSYGSMLIALPWGVATAIYLQEYARP
GPLVHAIRLTINNLAGVPSVVFGLFGLSMFVTAMKMGVSLLAGMFTLAALVLPLIIGASE
EALRSVSQTYREASLGLGATKWQTISLVVLPAALPSILTGAILAVGRAAGETAAIMFTAA
MFFSPRLPGSLFDSVMALPYHIYVLATAGTEIELTRPMQFGTSLVLIVLVLGMNLMAIIM
RARLQRRLR