Protein Info for DVU2478 in Desulfovibrio vulgaris Hildenborough JW710

Name: pstC-2
Annotation: phosphate ABC transporter, permease protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 65 to 95 (31 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 259 to 283 (25 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 9 to 287 (279 residues), 286.5 bits, see alignment E=9.7e-90 PF00528: BPD_transp_1" amino acids 84 to 286 (203 residues), 83.1 bits, see alignment E=1.1e-27

Best Hits

Swiss-Prot: 40% identical to YQGH_BACSU: Probable ABC transporter permease protein YqgH (yqgH) from Bacillus subtilis (strain 168)

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to dvu:DVU2478)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728X4 at UniProt or InterPro

Protein Sequence (295 amino acids)

>DVU2478 phosphate ABC transporter, permease protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSRRAKDNMVHGAFWTAAALCIVTLTLIMVFLFMEGFPIFQHVSLADFIFGKLWYPTFDP
PEFGILPMIVGSLVVTALSSLIAIPLGIMTAIYLAELAGPRMRAYVKPLVEMLQALPSVV
IGFFGMVIVAPWLQETFDIATGLNIANASIMLAFMAVPTITSIAEDAIYSVPNDMREASL
ALGATHWQTIGRVVVPAALPGISTAVILGMARSIGETMVVLMVAGGAAMLPGSIFDPSRP
MPASIAAEMAEAPFRSDHYHALFATGLVLFFFTLAFNALAAWIAEKKKQVGTATL