Protein Info for DVU2477 in Desulfovibrio vulgaris Hildenborough JW710

Name: pstS
Annotation: phosphate ABC transporter, periplasmic phosphate-binding protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF12849: PBP_like_2" amino acids 18 to 256 (239 residues), 166.2 bits, see alignment E=2.6e-52 TIGR02136: phosphate binding protein" amino acids 22 to 269 (248 residues), 277.6 bits, see alignment E=5.5e-87 PF13531: SBP_bac_11" amino acids 30 to 266 (237 residues), 57.9 bits, see alignment E=2.7e-19 PF01547: SBP_bac_1" amino acids 33 to 259 (227 residues), 45.9 bits, see alignment E=1.6e-15 PF12727: PBP_like" amino acids 42 to 205 (164 residues), 44.5 bits, see alignment E=2.1e-15

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to dvu:DVU2477)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728X5 at UniProt or InterPro

Protein Sequence (270 amino acids)

>DVU2477 phosphate ABC transporter, periplasmic phosphate-binding protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSIKRFALVALMTLGLAANAFAADKIVVKGSTTVLPIMQKAAEAYMKKTPGVEIEISGGG
SGNGIKALIDGTLDICMSSRKIKDKEVEAAKANGREAVEHIVALDAILPIVNKGNPVDNL
TIDQLRAIYEGKITNWKEVGGKDEAIVVISRDTSSGTYESWQHFVMKDAKVFPGALLQAS
SGAVLQAVSKNSKAISYDGIGYVNDTVKATKVNGVTGSAATAKDGSYAMARDLQIYTPGQ
PQGAVKNFIDFMKSAEGQALVQEAGFIPTK