Protein Info for DVU2476 in Desulfovibrio vulgaris Hildenborough JW710

Name: gltA
Annotation: glutamate synthase, small subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 TIGR01316: glutamate synthase (NADPH), homotetrameric" amino acids 20 to 470 (451 residues), 544.7 bits, see alignment E=8.1e-168 PF14691: Fer4_20" amino acids 25 to 132 (108 residues), 153.6 bits, see alignment E=4e-49 PF07992: Pyr_redox_2" amino acids 153 to 461 (309 residues), 114.3 bits, see alignment E=1.9e-36 PF13450: NAD_binding_8" amino acids 157 to 188 (32 residues), 26.7 bits, see alignment (E = 1.4e-09) PF00070: Pyr_redox" amino acids 295 to 370 (76 residues), 22.8 bits, see alignment E=2.8e-08

Best Hits

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 100% identity to dvu:DVU2476)

Predicted SEED Role

"glutamate synthase (NADPH), homotetrameric"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13, 1.4.1.14

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728X6 at UniProt or InterPro

Protein Sequence (476 amino acids)

>DVU2476 glutamate synthase, small subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNSDKKGRSLQPRVPMPCQPAHERVGNFHEVALGYSREDAMREASRCLQCKKPKCVKGCP
VEVQIPQFIAALAKGDVESAYRTLRETNSLPAVCGRVCPQENQCEGACILGAKGQPVAIG
RLERYAADTYMALDACDQLTGRPECPLIDPDLKVACIGSGPASLTVAGYLSSRGFKVTVY
EALHELGGVLVYGIPEFRLPKSDIVEKEIAALRQQEVEFVTNWVGGRTFSIDDLFAEGYK
AVFIGVGAGLPRFLDIPGENLVGVFSANEYLTRVNLGRAYGFPDYDTPVYRGREVTVFGG
GNVAMDAARTALRLGAESVRIVYRRTRDEMPARLEELEHAEEEGVRLELLAAPLGFKGDA
DGRLTAVTLQRMELGEPDASGRRSPRPVEGAVYDLPTDLAVIAVGTRPNPILLEATPGLT
LDRRGYIAVDEATGMTSIPGVYAGGDIVTGAATVILAMGAGRRAAKDIEARLRPAT