Protein Info for DVU2476 in Desulfovibrio vulgaris Hildenborough JW710

Name: gltA
Annotation: glutamate synthase, small subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01316: glutamate synthase (NADPH), homotetrameric
  • amino acids 20 to 470 (451 residues), 544.7 bits, E=8.1e-168
• PF14691: Fer4_20
  • amino acids 25 to 132 (108 residues), 151.7 bits, E=1.6e-48
• PF07992: Pyr_redox_2
  • amino acids 153 to 461 (309 residues), 114.3 bits, E=1.9e-36
• PF13450: NAD_binding_8
  • amino acids 157 to 188 (32 residues), 26.1 bits, see alignment (E = 2.1e-09)
• PF00070: Pyr_redox
  • amino acids 295 to 370 (76 residues), 23.6 bits, E=1.5e-08

Best Hits

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 100% identity to dvu:DVU2476)

Predicted SEED Role

"glutamate synthase (NADPH), homotetrameric"

MetaCyc Pathways

• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• L-glutamate biosynthesis IV (1/1 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of ammonia assimilation (plants) (2/3 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13, 1.4.1.14

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Sequence Analysis Tools

See Q728X6 at UniProt or InterPro

Protein Sequence (476 amino acids)

>DVU2476 glutamate synthase, small subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNSDKKGRSLQPRVPMPCQPAHERVGNFHEVALGYSREDAMREASRCLQCKKPKCVKGCP
VEVQIPQFIAALAKGDVESAYRTLRETNSLPAVCGRVCPQENQCEGACILGAKGQPVAIG
RLERYAADTYMALDACDQLTGRPECPLIDPDLKVACIGSGPASLTVAGYLSSRGFKVTVY
EALHELGGVLVYGIPEFRLPKSDIVEKEIAALRQQEVEFVTNWVGGRTFSIDDLFAEGYK
AVFIGVGAGLPRFLDIPGENLVGVFSANEYLTRVNLGRAYGFPDYDTPVYRGREVTVFGG
GNVAMDAARTALRLGAESVRIVYRRTRDEMPARLEELEHAEEEGVRLELLAAPLGFKGDA
DGRLTAVTLQRMELGEPDASGRRSPRPVEGAVYDLPTDLAVIAVGTRPNPILLEATPGLT
LDRRGYIAVDEATGMTSIPGVYAGGDIVTGAATVILAMGAGRRAAKDIEARLRPAT