Protein Info for DVU2470 in Desulfovibrio vulgaris Hildenborough JW710

Name: b0786
Annotation: membrane protein, putaive (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 73 (28 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details PF01027: Bax1-I" amino acids 16 to 232 (217 residues), 197.9 bits, see alignment E=9.3e-63

Best Hits

Swiss-Prot: 54% identical to YBHL_ECOLI: Inner membrane protein YbhL (ybhL) from Escherichia coli (strain K12)

KEGG orthology group: K06890, (no description) (inferred from 100% identity to dvl:Dvul_0772)

Predicted SEED Role

"membrane protein, putaive"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728Y2 at UniProt or InterPro

Protein Sequence (233 amino acids)

>DVU2470 membrane protein, putaive (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MYNRTMGSAARVEATNAYMRGVYSWMTLGLAVTAAAAWGVASSEALIAFIFGNTFVFFGL
IIAEFALVIGISAGIARLSAGMASGLFLLYSALNGLTLSSILLVYAQSAVFQAFITTAGM
FAVMSIYGATTKRDLTSMGSFLMMGLFGIILASVVNIFMRSSMMEFIISAVGVLVFTGLT
AYDTQKLKAFGENAPMDDAVAIRRGTILGALTLYLDFVNLFIMMVRLFGSSRD