Protein Info for DVU2462 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: oligopeptide ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 36 to 59 (24 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 163 to 180 (18 residues), see Phobius details amino acids 215 to 244 (30 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details PF12911: OppC_N" amino acids 34 to 75 (42 residues), 30.4 bits, see alignment 2.9e-11 PF00528: BPD_transp_1" amino acids 116 to 300 (185 residues), 109.2 bits, see alignment E=2.1e-35

Best Hits

Swiss-Prot: 48% identical to APPC_BACSU: Oligopeptide transport system permease protein AppC (appC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to dvl:Dvul_0778)

MetaCyc: 46% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728Z0 at UniProt or InterPro

Protein Sequence (300 amino acids)

>DVU2462 oligopeptide ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNAPHSNAGTETGTPFVPPPATTSRPSTSRFWQRNILFAIGFAIVGSMSLLALLAPWIAP
YDPTALHLDTILSGPSATHLLGTDALGRDVLSRLLYGARVSLWVGFVSVGIAVAIGLAVG
LVAGYFGGIIDELAMRLVDIMLCFPSFFLILAVIAFLEPSLGNIMAVIGLTSWMGVARLV
RAETLSLREREFVAAARLAGAGRTRIILTHILPNAMAPVLVSATLGVAGAILTESALSFL
GLGVQPPDPSWGNMLLEGKDVLEIAPWMSLFPGLAILVTVLGYNLLGESLRDFLDPRLKK