Protein Info for DVU2449 in Desulfovibrio vulgaris Hildenborough JW710

Name: metK
Annotation: S-adenosylmethionine synthetase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 PF00438: S-AdoMet_synt_N" amino acids 7 to 105 (99 residues), 150.9 bits, see alignment E=2e-48 TIGR01034: methionine adenosyltransferase" amino acids 10 to 388 (379 residues), 575.8 bits, see alignment E=2e-177 PF02772: S-AdoMet_synt_M" amino acids 118 to 237 (120 residues), 151.2 bits, see alignment E=2.1e-48 PF02773: S-AdoMet_synt_C" amino acids 239 to 377 (139 residues), 214.7 bits, see alignment E=6.4e-68

Best Hits

Swiss-Prot: 100% identical to METK_DESVH: S-adenosylmethionine synthase (metK) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 100% identity to dvl:Dvul_0786)

MetaCyc: 58% identical to S-adenosylmethionine synthetase monomer (Bacillus subtilis)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729A3 at UniProt or InterPro

Protein Sequence (391 amino acids)

>DVU2449 S-adenosylmethionine synthetase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIPSKGKYYFTSESVTEGHPDKVADQISDAVLDVLLAQDPNSRVACETLVTTGMAVIAGE
ITTRGYADLPHVVRETIRNIGYNSSEMGFDWQTCAVISSIDKQSADIAQGVDRATNEDQG
AGDQGMMFGFACDETATLMPAPIYWAHQLSQRLTEVRKDGTVDIFRPDGKTQVSFEYVDG
KPVRINNVVVSTQHKDSASQADIIDAVKTHVIRPILEPSGFFDEKACDIFINTTGRFVIG
GPMGDCGLTGRKIIQDTYGGMGHHGGGAFSGKDASKVDRSGAYMARYIAKNVVASGLAPK
CEVQIAYCIGVAEPVSVLVSSQGTASVPDEVLTRAVREVFDLRPFHITRRLDLLRPIYGK
TSCYGHFGRELPEFTWEHTDAAADLRTAAKV