Protein Info for DVU2446 in Desulfovibrio vulgaris Hildenborough JW710

Name: panB
Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF02548: Pantoate_transf" amino acids 22 to 276 (255 residues), 381 bits, see alignment E=1.4e-118 TIGR00222: 3-methyl-2-oxobutanoate hydroxymethyltransferase" amino acids 23 to 281 (259 residues), 323.4 bits, see alignment E=5.8e-101

Best Hits

Swiss-Prot: 100% identical to PANB_DESVH: 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 100% identity to dvl:Dvul_0789)

MetaCyc: 49% identical to 3-methyl-2-oxobutanoate hydroxymethyltransferase (Thermococcus kodakarensis)
3-methyl-2-oxobutanoate hydroxymethyltransferase. [EC: 2.1.2.11]

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729A6 at UniProt or InterPro

Protein Sequence (307 amino acids)

>DVU2446 3-methyl-2-oxobutanoate hydroxymethyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSTHTPPSSATPTSGQGVRPLTTADIRKAKGRQRLAMLTAYDYTSARIVDGAGADLILVG
DSLGMVMLGREDTLSVTLDEMLHHCRAVVRGTRHAMVVADMPFMTYETGVRDALLNGARL
FRESGVRAVKLEGAGPVLPQVRALVDAGIPVMGHLGLTPQRVAEMGGFKVQGRQAEAALR
LFDDALALQEAGCFSLVLECVPAPVAEQVTARLHIPTIGIGAGAGCDGQVLVLHDMLGLY
GELSPRFVKRYADLAGMAGEAVARYAHEVREGSFPAAEHTFGIDDGQFEAFMAALDKRGC
RQTPTGE