Protein Info for DVU2437 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details transmembrane" amino acids 283 to 306 (24 residues), see Phobius details amino acids 332 to 358 (27 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 19 to 244 (226 residues), 126.8 bits, see alignment E=1.5e-40 PF02687: FtsX" amino acids 287 to 396 (110 residues), 55.3 bits, see alignment E=6.8e-19

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to dvu:DVU2437)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729B4 at UniProt or InterPro

Protein Sequence (406 amino acids)

>DVU2437 ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRGLGIILKSLAAHRTRALLAMLGVFLGALALTAVMHVAGAMVLKADLETQKLGPNLLQA
LSGQVRFRRDGPSGVSGVNRTFTLQDAEAILGGVAQVRDGVPYCNAPMPVRYGSIKTTSQ
LVATLPGFARVRAYSPAYGRFISDEDEAGRALVCVLGTAIATRLFERPDNAVGRTVFFFR
APVQVVGVMEEKGQDVSGTNLDEQVYVPLSTYMRRMANQDWISGVYMNLHDGADEEAARA
AVTAILRSRHLIAAGQKDDFSVLSARDANKLRKEALDLVQTLGVLSSSISFAVGSLGILS
IMTLLVRARRLEIGVRRAVGASRNVIVRQFLAEAGLMAGVGGTLGVVVALALVTVVYAVG
DFPYTYDPLLAAGACIASVVLGVAAGAYPAWQASRVDVLDVLRHPE