Protein Info for DVU2435 in Desulfovibrio vulgaris Hildenborough JW710

Name: corA
Annotation: transporter, CorA family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 256 to 276 (21 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details PF01544: CorA" amino acids 24 to 310 (287 residues), 220.7 bits, see alignment E=1.3e-69

Best Hits

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 100% identity to dvl:Dvul_0800)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729B6 at UniProt or InterPro

Protein Sequence (315 amino acids)

>DVU2435 transporter, CorA family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDIRTLYLHGDGDTTRTTDSPVEGGIVWYDMDIDMDDDPTPALTGLGLPPHILESCLATR
RFPETEAFAGGVLLHMPVRQQWNAPRATYLTLLMLAGKVVSLHRAPLPVTVKTAQRLTMG
DAPHLGLARDLFLYLLEAVIETNIQNFVEARSHIEELSRTLDETPDAVGVDDILPFKRNV
ARLTVQHEEQFYCLTALQGIFAGGAPNAQRDPRLRDMLDTQAHLARSADRMEYRLRDMQQ
HCHYVMQERTEQRLRILTILSSIYMPLTLIAGIYGMNFKAMPELDWEYGYFAVLGLMAAT
AAGLLWFFRRRGWLG