Protein Info for DVU2410 in Desulfovibrio vulgaris Hildenborough JW710

Name: sodB
Annotation: superoxide dismutase, Fe (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF00081: Sod_Fe_N" amino acids 1 to 82 (82 residues), 78.5 bits, see alignment E=4.5e-26 PF02777: Sod_Fe_C" amino acids 92 to 195 (104 residues), 125.1 bits, see alignment E=1.1e-40

Best Hits

Swiss-Prot: 62% identical to SODF_SYNY3: Superoxide dismutase [Fe] (sodB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 100% identity to dvu:DVU2410)

MetaCyc: 49% identical to superoxide dismutase (Fe) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729E1 at UniProt or InterPro

Protein Sequence (196 amino acids)

>DVU2410 superoxide dismutase, Fe (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPPLPYPDTALEPAISARTISFHYGKHTAAYYANLNKAVAGTPMATMRLEDVVKSVAGDP
AKAGLFNNAAQSWNHTFYWAGMKPGGGGTPPAKVADALKASFGSVEACMEQLSEAAKTQF
ASGWAWLAKGTENGKPVLKVMKTGNADNPMTQGLTPVLTIDVWEHAYYLDYQNKRPDYVK
AFFEKLVNWDEVATRL