Protein Info for DVU2409 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: bacterial extracellular solute-binding proteins, family 3 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 69 to 84 (16 residues), see Phobius details PF00497: SBP_bac_3" amino acids 44 to 261 (218 residues), 50.9 bits, see alignment E=6.9e-18

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 100% identity to dvl:Dvul_0823)

Predicted SEED Role

"bacterial extracellular solute-binding proteins, family 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729E2 at UniProt or InterPro

Protein Sequence (270 amino acids)

>DVU2409 bacterial extracellular solute-binding proteins, family 3 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDTGGGQVKNCFRIGLLALMVSGLSVMGFGTDASRAESTSRPVIATADPWPPYADPAHPA
HGLTLEILSLALGRSGYTVTMVYLPWVRAEQRLERGGVDLLINCWRTEARAKRYLFSRPF
ARNRLLFMQRAGESFVFAGQESLKGKTVGTIRGYGYTDAFMADTSIRREEVTNFKDNVRK
LVSGRVDLIIEDELVARTQLEQLPADLAGQVAFIEPPLVTNDLYVVAYPDNPGAQDIIRA
FDAGLAAMIADGSYKALMERYDAAESRVDR