Protein Info for DVU2403 in Desulfovibrio vulgaris Hildenborough JW710

Name: hdrB
Annotation: heterodisulfide reductase, B subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF02754: CCG" amino acids 4 to 86 (83 residues), 45.8 bits, see alignment E=2.8e-16 amino acids 147 to 237 (91 residues), 45.8 bits, see alignment E=2.8e-16

Best Hits

KEGG orthology group: K03389, heterodisulfide reductase subunit B [EC: 1.8.98.1] (inferred from 100% identity to dvl:Dvul_0827)

Predicted SEED Role

"CoB--CoM heterodisulfide reductase subunit B (EC 1.8.98.1)" in subsystem Anaerobic respiratory reductases or H2:CoM-S-S-HTP oxidoreductase or Methanogenesis (EC 1.8.98.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.98.1

Use Curated BLAST to search for 1.8.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729E8 at UniProt or InterPro

Protein Sequence (334 amino acids)

>DVU2403 heterodisulfide reductase, B subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNLAYYPGCSGLGTSREYERSTRAVCAALGVALTEIPDWSCCGSTPAHALDHTLSGALSA
RNLVGAARAGCEAVATPCPSCLSNLKTARHRMADDGFRAAVGRLLDEPADALATLPDVHS
MLEMLVTRVGLDAIRAKVRRPLAGLRVAPYYGCIMTRPADVMRFDDPENPTSMDDLLTAL
GAEVVPYPYKVECCGASYGVARNDIVARLSGRLLGAARDAGAHAVVVACPLCQMNLDLRQ
PQVTWPGGHAMDMPVFYFTQLLGRALGVPESELGLEQLCVDPAIAFRRAEQALAAREAEK
AAAVRSGKATTVRASAAAGQDGPDEAGRAEGGRA