Protein Info for DVU2399 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: hydrogenase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 135 to 149 (15 residues), see Phobius details PF00175: NAD_binding_1" amino acids 135 to 238 (104 residues), 59.2 bits, see alignment E=6.1e-20 PF10418: DHODB_Fe-S_bind" amino acids 256 to 288 (33 residues), 46.8 bits, see alignment 2e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0831)

Predicted SEED Role

"Heterodisulfide reductase, cytochrome reductase subunit" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729F2 at UniProt or InterPro

Protein Sequence (295 amino acids)

>DVU2399 hydrogenase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPDAITPEAGAHVTTLGSGFTDNPYLPDVATVLETVQETPAIKTLRVRIDDAARMDAFRF
NPGQVGQLSLFGVGESTFVINSPPTRMDYLQFSIMRAGEVTAALHGLKPGDKVGVRAPLG
NWFPFEDMRGKDIVFVGGGIGMAPLRTLLLYMLDNRADYGNITLLYGARTPGDMAFRDDV
QDWLGRSDMNTTLTVDQAPDDWPHRAGLIPHVLLDLAPSNANSVAVLCGPPIMIKFTVEA
LKKLHFADEQIITTLERRMKCGIGICGRCNIGTKYVCVDGPVFSYAELKELPNEL