Protein Info for DVU2394 in Desulfovibrio vulgaris Hildenborough JW710

Name: ntrC1
Annotation: sigma-54 dependent transcriptional regulator/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF00072: Response_reg" amino acids 7 to 115 (109 residues), 96.2 bits, see alignment E=5e-31 PF00158: Sigma54_activat" amino acids 145 to 312 (168 residues), 205.4 bits, see alignment E=1.8e-64 PF14532: Sigma54_activ_2" amino acids 146 to 316 (171 residues), 84.9 bits, see alignment E=2.2e-27 PF07728: AAA_5" amino acids 168 to 293 (126 residues), 34.6 bits, see alignment E=6.6e-12 PF01078: Mg_chelatase" amino acids 224 to 294 (71 residues), 22.9 bits, see alignment E=1.8e-08 PF02954: HTH_8" amino acids 419 to 460 (42 residues), 45.9 bits, see alignment 1.4e-15 PF18024: HTH_50" amino acids 420 to 462 (43 residues), 27.5 bits, see alignment 7e-10

Best Hits

KEGG orthology group: K02481, two-component system, NtrC family, response regulator (inferred from 100% identity to dvu:DVU2394)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729F7 at UniProt or InterPro

Protein Sequence (463 amino acids)

>DVU2394 sigma-54 dependent transcriptional regulator/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRTSYSVLAVDDEPSIGKLLEKELSTPARAVHVAGSARQARERLRRATYEVVVLDIRLPD
ADGIEFMVELRQRYPDMEVILITGHGNIDNAVEAMKLGAYDYITKPFNLTELEVVVERAY
QRAFLRNENRALRHAHDRGRPGVTLIGNSQVIKEVRYLIEKVAPTDVPVLITGESGAGKE
VAAHAIQSLGTRADKPFIIKNCATLQKELARSELFGHVRGSFTGALESRDGLMAFANKGT
LFLDEIGELPMEVQASLLRVLENKTYRRVGEKDHRSCDIRLIFATNRTLAGEVEAGRFHE
ALYHRINVFNIEMPPLRERKEDIPLLAEFFLARLGNGRDDLRISDRAMSCLMQYAWPGNV
RELRNVLERSIILAENNLITEHALPRDLAGFAGGGGGQSGVSGVPGASGAMGEAQGPLSL
EAMEREHIARILEFYDNNRSLAATALGISRKTLYRKMREYDIG