Protein Info for DVU2376 in Desulfovibrio vulgaris Hildenborough JW710

Name: lysS
Annotation: lysyl-tRNA synthetase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 TIGR00499: lysine--tRNA ligase" amino acids 37 to 526 (490 residues), 662.6 bits, see alignment E=1.8e-203 PF01336: tRNA_anti-codon" amino acids 92 to 168 (77 residues), 68.5 bits, see alignment E=5.9e-23 PF00152: tRNA-synt_2" amino acids 185 to 522 (338 residues), 306.2 bits, see alignment E=3.5e-95

Best Hits

Swiss-Prot: 53% identical to SYK_CROS8: Lysine--tRNA ligase (lysS) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K04567, lysyl-tRNA synthetase, class II [EC: 6.1.1.6] (inferred from 100% identity to dvu:DVU2376)

Predicted SEED Role

"Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)" (EC 6.1.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729H5 at UniProt or InterPro

Protein Sequence (527 amino acids)

>DVU2376 lysyl-tRNA synthetase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
LSIQEQPKRKKVKLPTKSAHADYFMPMLESLEARDELNEVVKNRVVKTCELLDAGVSAYP
NGFIKKHDIAPVLAEYEGLDADELETVDAAFTMAGRIVSHRSFGKVAFFHIMDRTGRMQC
YAAREELGEEAYKTFKKLDIGDIVGVSGRLFRTKTGELTLSCTEVRLLTKSIRPLPEKYH
GLKDVEIRYRQRYVDLIVTPRARDIFRKRTIIVREFRRFLEARGFMEVETPMMQAIPGGA
TAKPFVTFHNALDMQLYMRIAPELYLKRLLVGGFEKVFEINRNFRNEGISTQHNPEFTMC
EFYWAYATFEDLMDLTEELFSHIAREVCGSSVITYQGQEVDLTPGKWVRLTFHESLEKVG
GHSPEFYNDYEKVRAYVRERGEKVLQGEKLGKLQAKLFDLDVEPRLIQPTFIYHYPTDIS
PLSRRNEQNPDVTDRFELFITGRELANAFSELNDPVDQRMRFEDQVKEKEAGDDEAHFMD
EDYLRALEYGMPPAAGQGVGIDRLVMLLTDSPSIREVILFPLLKPES