Protein Info for DVU2359 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sigma-54 dependent transcriptional regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 PF01590: GAF" amino acids 87 to 163 (77 residues), 30.6 bits, see alignment E=1.5e-10 PF00158: Sigma54_activat" amino acids 225 to 391 (167 residues), 237.6 bits, see alignment E=2.2e-74 PF14532: Sigma54_activ_2" amino acids 231 to 396 (166 residues), 57.7 bits, see alignment E=5.7e-19 PF00004: AAA" amino acids 249 to 384 (136 residues), 26.8 bits, see alignment E=2.2e-09 PF07728: AAA_5" amino acids 249 to 368 (120 residues), 34.8 bits, see alignment E=5.5e-12 PF25601: AAA_lid_14" amino acids 397 to 468 (72 residues), 84.1 bits, see alignment E=1.8e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0902)

Predicted SEED Role

"Hydrogenase-4 transcriptional activator" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729J1 at UniProt or InterPro

Protein Sequence (551 amino acids)

>DVU2359 sigma-54 dependent transcriptional regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLQPGKFTRIAPHVLREFDISPFFDLLLSMAQERTVEGLLQLSTRVYRGTHVACGGVWFT
EKASGDDGAGWVMRLMTLAGRTHRHPRTWTHTAGDYSLIPPQEPLLGAVALSGEPLVVAS
PDEWTRPEWAVDEGFAAYSAFPMMCKGELVGLLALFYERPMTDRLGDLLSLHYKMHKIYA
DSLAAAITNARAFEEILHLRRELERENERLRRQVEHGSADGNLPIVGDCPAWLRVLAQVD
MVAPTDATVLVQGESGTGKELVAEAIHRRSQRSTAPLVRVNCSAIPRELFESEFFGHVKG
AFTGAVRDRIGRFQMADGGTLFLDEVGEIPLELQGKLLRVLQEGTFERVGEDRTRSVDVR
IIAATNRDLRQEVDAGRFRQDLFFRLSVFPVELPPLRDRQGDIPLLARHFIAQSSRRLGL
PTPRLTPAALARLSAYPWPGNVREMQNVIERAVIMAEEGALGMDALPAPEGLRHDDRVSV
AAPAPGATTIVTEEEWRTMQRDNIRRALQAAEGRVHGVGGAAELLGIPPTTLRSRMQALG
LSPKQGHGPKG