Protein Info for DVU2356 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 57 (19 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 412 to 431 (20 residues), see Phobius details amino acids 451 to 474 (24 residues), see Phobius details PF16980: CitMHS_2" amino acids 34 to 474 (441 residues), 679.4 bits, see alignment E=2.1e-208

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0905)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729J4 at UniProt or InterPro

Protein Sequence (475 amino acids)

>DVU2356 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRFLPLAAIATSLMALTPGMALAAGGHLDLDGATLPVLWTIPFACMLLSIAVMPLTVPHF
WHHHFGKVSAFWALAFAVPCAVQFGLSLTVYQLLHAFLLEYVPFIILLFSLFTVAGGVRL
KGSLVGTPVVNTGILAVGTLLASWMGTTGAAMLLIRPLLRANKHRRYRVHSVVFFIFLVA
NIGGSLTPLGDPPLFLGFLKGVSFFWTTSHLFMKTVILSLILIAVFYVLDTVLFNREGRP
MPEKDTAGTGERLGLDGMVNLPLLGGVVALVLMSGLWKPGVMFNVYGVELELQNIARDLG
LLLVAALSLKLTSTECRRLNDFTWAPIEEVAKLFLGIFVSMIPAIAILKAGDKGALASVI
NMVTANGEPVNAMYFWLTGLLSSFLDNAPTYLVFFNTAGGDAMHLMNDIPETLAAISAGA
VFMGACTYIGNAPNFMVRSIAEEQGVPMPSFFGYILWSCAFLVPCFVLLTWLFFI