Protein Info for DVU2348 in Desulfovibrio vulgaris Hildenborough JW710

Name: dut
Annotation: deoxyuridine 5-triphosphate nucleotidohydrolase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 TIGR00576: dUTP diphosphatase" amino acids 39 to 169 (131 residues), 138.4 bits, see alignment E=6.8e-45 PF00692: dUTPase" amino acids 39 to 168 (130 residues), 85.4 bits, see alignment E=2.9e-28 PF22769: DCD" amino acids 58 to 141 (84 residues), 39.5 bits, see alignment E=6.6e-14

Best Hits

Swiss-Prot: 49% identical to DUT_HALHL: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Halorhodospira halophila (strain DSM 244 / SL1)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 99% identity to dvl:Dvul_0913)

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729K2 at UniProt or InterPro

Protein Sequence (170 amino acids)

>DVU2348 deoxyuridine 5-triphosphate nucleotidohydrolase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
VTSPCQNVLSPSMPGVRVLYLRDARALYTADAESGSGLAYATPGSAGLDLRACFDAAEVT
LLPGERFMVPSGVAVEPLVQGMAGFVYSRSGLGARMGLTVSQGVGVIDPDYRGEIIVSLL
NTSREPRRLRRGERMAQLVFQPFCRVALEEVASLGETDRGAGGFGHTGRI