Protein Info for DVU2340 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 62 to 87 (26 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 25 to 117 (93 residues), 89.1 bits, see alignment E=1.1e-29 PF00528: BPD_transp_1" amino acids 42 to 224 (183 residues), 75.8 bits, see alignment E=1.8e-25

Best Hits

Swiss-Prot: 40% identical to YECS_SHIFL: L-cystine transport system permease protein YecS (yecS) from Shigella flexneri

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 100% identity to dvu:DVU2340)

MetaCyc: 40% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"ABC-type amino acid transport system, permease component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729L0 at UniProt or InterPro

Protein Sequence (230 amino acids)

>DVU2340 amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQWDVVWNNMNYLLVGSYPDGPLGGMAMSILLAIGGIFGAFWLGLAFGLMRLSEKWWVRA
PAIVYVEVIRGIPLLMLIFWFYFLAPIALGHTLPEAESALIAFIVFTGAYIAEIVRAGVL
ALPAGQMEAARGTGLSKTQAMLFVILPQALRNMIPSFVNQFVSLTKDTSLAYIIGVSELT
RTATQVNNRTLTAPTEIFLTIALMYFVICWVLTATSRRLEKQMARYQART