Protein Info for DVU2336 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: carboxyl-terminal protease (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF22694: CtpB_N-like" amino acids 28 to 78 (51 residues), 35.1 bits, see alignment 4e-12 TIGR00225: C-terminal processing peptidase" amino acids 47 to 359 (313 residues), 345 bits, see alignment E=2.2e-107 PF00595: PDZ" amino acids 90 to 162 (73 residues), 47.9 bits, see alignment E=3.6e-16 PF13180: PDZ_2" amino acids 96 to 168 (73 residues), 41.2 bits, see alignment E=4e-14 PF17820: PDZ_6" amino acids 109 to 161 (53 residues), 48.6 bits, see alignment 1.4e-16 PF03572: Peptidase_S41" amino acids 196 to 356 (161 residues), 188.5 bits, see alignment E=1.7e-59

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 100% identity to dvl:Dvul_0923)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729L4 at UniProt or InterPro

Protein Sequence (428 amino acids)

>DVU2336 carboxyl-terminal protease (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRVTLWVVSLGLCAAVAFSGGAVFATTEESKYDALKRFSQVLDIVERYYVRDVPRKDLMN
GAVKGMLQGLDPHSTFLSPEEFKEMQETTSGEFFGIGIEISSENGQLTVVSPIEDTPAFK
AGLKAGDLILAVDGQPTQEMSTQEAVSRIRGPKGSEVELLILHREAKAPSTVKIVRDAIP
LVSVKSKQLEQGYVWVRLTRFSERTTSDLLEALREANKRGPVKGVVLDLRNNPGGLLDQA
VSVSDVFLRDGGIVSIRGRGDDTGREYNAKAQSTDVTAPMVVLINAGSASASEIVAGALR
DQKRALLVGERSFGKGSVQNVIPLSDGAGLKLTVALYYTPNGRSIQAEGIDPDIEIPFEA
PREDDAKPMQRFNMLREKDLSRHLENGAGGKQGKNDQSDEVRDLLERDNQLRMALQFVKR
LPALKEIR