Protein Info for DVU2332 in Desulfovibrio vulgaris Hildenborough JW710

Name: proC
Updated annotation (from data): pyrroline-5-carboxylate reductase (EC 1.5.1.2)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00112.
Original annotation: pyrroline-5-carboxylate reductase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03807: F420_oxidored
  • amino acids 5 to 95 (91 residues), 51.7 bits, E=1.7e-17
• PF03446: NAD_binding_2
  • amino acids 5 to 93 (89 residues), 37.6 bits, E=3.6e-13
• TIGR00112: pyrroline-5-carboxylate reductase
  • amino acids 6 to 263 (258 residues), 243.8 bits, E=1.2e-76
• PF14748: P5CR_dimer
  • amino acids 159 to 263 (105 residues), 116.1 bits, E=1.3e-37

Best Hits

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 100% identity to dvl:Dvul_0926)

MetaCyc: 37% identical to pyrroline-5-carboxylate reductase (Hordeum vulgare)
Pyrroline-5-carboxylate reductase. [EC: 1.5.1.2]

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-proline biosynthesis III (from L-ornithine) (2/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)
• L-arginine degradation VI (arginase 2 pathway) (2/4 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

See Q729L8 at UniProt or InterPro

Protein Sequence (265 amino acids)

>DVU2332 pyrroline-5-carboxylate reductase (EC 1.5.1.2) (Desulfovibrio vulgaris Hildenborough JW710)
MQTTLGCIGCGNMGSAILRGLSGREGLRLVGCDPTGAKLAALADAGVEGVADIAAAVRAS
DIVLVAVKPGQVGAVLGAAMPELDSGKVVVSIASGVSVGSLREMSGGRCPVVRVMPNTPA
MVGAGVFALCFEDATLDEVRRTLVKELFEALGRVLVLPEEKFNAFTAVVGCGPAYVFHFM
EAVVEAAVTLGFPRHEATDMVVDLFAGSVKLAATSGTHLSLLREAVCSPAGNTIAAMNQF
DRDAVRGRIIDAILAAYRRGQEMER