Protein Info for DVU2332 in Desulfovibrio vulgaris Hildenborough JW710

Name: proC
Updated annotation (from data): pyrroline-5-carboxylate reductase (EC 1.5.1.2)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00112.
Original annotation: pyrroline-5-carboxylate reductase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF03446: NAD_binding_2" amino acids 5 to 93 (89 residues), 37.6 bits, see alignment E=3.6e-13 PF03807: F420_oxidored" amino acids 5 to 95 (91 residues), 51.7 bits, see alignment E=1.7e-17 TIGR00112: pyrroline-5-carboxylate reductase" amino acids 6 to 263 (258 residues), 243.8 bits, see alignment E=1.2e-76 PF14748: P5CR_dimer" amino acids 159 to 263 (105 residues), 116.1 bits, see alignment E=1.3e-37

Best Hits

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 100% identity to dvl:Dvul_0926)

MetaCyc: 37% identical to pyrroline-5-carboxylate reductase (Hordeum vulgare)
Pyrroline-5-carboxylate reductase. [EC: 1.5.1.2]

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729L8 at UniProt or InterPro

Protein Sequence (265 amino acids)

>DVU2332 pyrroline-5-carboxylate reductase (EC 1.5.1.2) (Desulfovibrio vulgaris Hildenborough JW710)
MQTTLGCIGCGNMGSAILRGLSGREGLRLVGCDPTGAKLAALADAGVEGVADIAAAVRAS
DIVLVAVKPGQVGAVLGAAMPELDSGKVVVSIASGVSVGSLREMSGGRCPVVRVMPNTPA
MVGAGVFALCFEDATLDEVRRTLVKELFEALGRVLVLPEEKFNAFTAVVGCGPAYVFHFM
EAVVEAAVTLGFPRHEATDMVVDLFAGSVKLAATSGTHLSLLREAVCSPAGNTIAAMNQF
DRDAVRGRIIDAILAAYRRGQEMER