Protein Info for DVU2330 in Desulfovibrio vulgaris Hildenborough JW710

Name: E.coliMinDlike)
Annotation: MRP family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF10609: ParA" amino acids 40 to 283 (244 residues), 310.7 bits, see alignment E=2.1e-96 PF02374: ArsA_ATPase" amino acids 42 to 79 (38 residues), 27.7 bits, see alignment 4.9e-10 PF09140: MipZ" amino acids 42 to 89 (48 residues), 29.5 bits, see alignment 1.5e-10 PF01656: CbiA" amino acids 44 to 261 (218 residues), 53.8 bits, see alignment E=6e-18 PF13614: AAA_31" amino acids 44 to 81 (38 residues), 34 bits, see alignment 8.4e-12

Best Hits

Swiss-Prot: 44% identical to NUBP1_DANRE: Cytosolic Fe-S cluster assembly factor nubp1 (nubp1) from Danio rerio

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0928)

Predicted SEED Role

"Cytosolic Fe-S cluster assembling factor NBP35"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729M0 at UniProt or InterPro

Protein Sequence (293 amino acids)

>DVU2330 MRP family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSEACSGCSSTAQGGCGGSGAQDLEAMAAQKRLKDNLARIRHRIVVMSGKGGVGKSTVAA
NLAAGLALAGKRVGLLDVDVHGPSIPRLLCLDQSKVDVEGDLIKPVMWGDNLKVMSLGFF
LPNGQQAVIWRGPVKIGFIQQLVGDVEWGDLDYLIVDCPPGTGDEPLSAVQLLNPGAHAL
VVTTPQAVAIDDVRRSLGFCAEIGIPVLGLVENMSGIVCSQCGNIEELFGKGGGEALAKE
MAVPFLAALPLDPQVVRSGDEGWVYIKHHPERPTALALRPVIDAALGLDAAKA