Protein Info for DVU2329 in Desulfovibrio vulgaris Hildenborough JW710
Name: hypB
Annotation: hydrogenase accessory protein HypB (TIGR)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 34% identical to HYPB_METJA: Probable hydrogenase maturation factor HypB (hypB) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K04652, hydrogenase nickel incorporation protein HypB (inferred from 100% identity to dvl:Dvul_0929)MetaCyc: 37% identical to hydrogenase/urease maturation factor HypB (Helicobacter pylori 26695)
RXN-22957
Predicted SEED Role
"[NiFe] hydrogenase nickel incorporation-associated protein HypB" in subsystem NiFe hydrogenase maturation
MetaCyc Pathways
- NiFe(CO)(CN)2 cofactor biosynthesis (1/10 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q729M1 at UniProt or InterPro
Protein Sequence (224 amino acids)
>DVU2329 hydrogenase accessory protein HypB (TIGR) (Desulfovibrio vulgaris Hildenborough JW710) MDIPVIRNVLEANDKMADQLRKLFARHGVLVLNLISSPGAGKTSVLERTLTDLRDEFRMA VVEGDLQTDNDARRVAATGARAVQINTDGGCHLDSNMVLDAISNFDLADLDILFIENVGN LVCPVEFDCGEDHKVALLSVTEGDDKPEKYPLLFNLSSVMLLNKVDLLPYVDFDVERARR FSTRLNQNLTIYELSCRSGEGLAPWYDWLREALKAKRAAAEAKA