Protein Info for DVU2320 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 PF20695: UbiD_N" amino acids 12 to 85 (74 residues), 80.2 bits, see alignment E=1.5e-26 PF01977: UbiD" amino acids 124 to 315 (192 residues), 209.5 bits, see alignment E=4.7e-66 PF20696: UbiD_C" amino acids 321 to 456 (136 residues), 93.5 bits, see alignment E=1.6e-30

Best Hits

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 100% identity to dvu:DVU2320)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729N0 at UniProt or InterPro

Protein Sequence (612 amino acids)

>DVU2320 3-octaprenyl-4-hydroxybenzoate carboxy-lyase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTYRNLSSCLIDLERNGHLIRIDTEVDARLELAAIQRRAFRAKAPAMLFTRVKGCRFPMV
ANLYGTRDRIRFIFRDTLRAVEGIFRLKIDPFDLFRHPQRYLGVPRSLWGMMPRTVRRGP
VLECRTTVRELPQLVSWPMDGGGYVTLPQVYTESPDRPGFMHSNMGMYRVQLTGDHYEPD
REVGLHYQIHRGIGYHHAEALRRGEPLRVNIFVGGPPAMTVAAVMPLPEGIAEVLFAGAL
GGFRIPMIRRAGGLPILAEADFCISGTIAPHQKPEGPFGDHLGYYSLAHDFPVLRVDAVH
HRRDAVWPFTTVGRPPQEDTVFGEFIHELTAALVPQVFAGVHEVHAVDAAGVHPLLLAVG
SERYVPYAGERQPQELITCGMALLGNTQTSLSKYVIIGAREDDHDLSAHDIPAFFTHMLE
RTDFSRDLHFITRTTIDTLDYTGISLNQGSKVVWAAAGSRRRDLADTLPETLTLPDGFGS
PRLFHKGIVVLRGPRHTARRDEHDPAMERLAQSLDDVRGLSGVPLFVVVDDADFTAADWD
NFLWVTFTRSDPATDLYGVGASTHCKHWGCRGPLIVDARLKSFHAPALETDPEVERRVDA
LAAPGGPLHGYL