Protein Info for DVU2303 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details PF08238: Sel1" amino acids 133 to 167 (35 residues), 19.2 bits, see alignment 7.5e-08 amino acids 169 to 204 (36 residues), 26.3 bits, see alignment 4.1e-10 amino acids 206 to 239 (34 residues), 27.7 bits, see alignment (E = 1.5e-10) amino acids 243 to 276 (34 residues), 23.2 bits, see alignment (E = 4.1e-09) amino acids 277 to 312 (36 residues), 22.6 bits, see alignment 6.2e-09 amino acids 313 to 348 (36 residues), 26.8 bits, see alignment 2.9e-10 amino acids 350 to 384 (35 residues), 16.9 bits, see alignment 3.8e-07

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2303)

Predicted SEED Role

"FIG00604021: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729P7 at UniProt or InterPro

Protein Sequence (475 amino acids)

>DVU2303 conserved domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSRTIAETPRPAVASMSSGCIPPHHRPDTLKQRWGTPAAVCLLVTCLFAMTLLTTGCKPP
RRTPPTLPDRPDMATVEQPVVPPATVDGKDLDAPQTPKERIALALRLLDDGGDGADPTQA
VQLIEQDATTGYAPAQDLLARLSLEGYGTAKDPARAFALAIEAARQGLPDAQRLAGTMYT
LGLGTARDLEQGMRWLREAADAGDGEAAAMVADYYRQGLGVERNDTEAFLWTHRAAERGV
KRAALWLGLHYHYGVGTPADQKQAFALLRPFADEGDAEALTIIALLLHKGEGVAQDRKAA
LRYFEKGAAAGDPVAQLDLGVLYHQGDGVTRDMDKARGLFRQCAEGGNARCMTLYASMLE
EGEGGPSDPAEALAWYMVASMAGDDDATPFLDDLRSRITAEQAAQGKVRATAIIRSLTAS
PAADEASRQSSGQTAGQASGHASGQTPESTSARTSAPVPSALPREAAGKRPTVLP