Protein Info for DVU2299 in Desulfovibrio vulgaris Hildenborough JW710

Name: proV
Annotation: glycine/betaine/L-proline ABC transporter, ATP binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 37 to 392 (356 residues), 442.7 bits, see alignment E=5.4e-137 PF00005: ABC_tran" amino acids 44 to 191 (148 residues), 123 bits, see alignment E=1.4e-39 PF00571: CBS" amino acids 284 to 329 (46 residues), 25.5 bits, see alignment 1.4e-09 amino acids 338 to 391 (54 residues), 31 bits, see alignment 2.7e-11

Best Hits

Swiss-Prot: 55% identical to OPUAA_BACSU: Glycine betaine transport ATP-binding protein OpuAA (opuAA) from Bacillus subtilis (strain 168)

KEGG orthology group: K05847, osmoprotectant transport system ATP-binding protein (inferred from 100% identity to dvu:DVU2299)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729Q1 at UniProt or InterPro

Protein Sequence (397 amino acids)

>DVU2299 glycine/betaine/L-proline ABC transporter, ATP binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSKLSIRNLTKIFGPHPEKALGLLEQGLGKEEIHRRTSHAVGVDRASFDVEEGEIVVVMG
LSGSGKSTLVRCLNRLIEPTAGTVTVDGRDVTSMPVDELRRLRQRSFGMVFQNFALFPHR
TVLQNAAFGLEAMGVPRAERERQAMVSLERVGLAEWAASRPAQLSGGMQQRVGLARALSL
DPDILLMDEAFSALDPLIRRDMQDELLRLQDDLQKTIVFISHDLDEALKLGDRIVLMRDG
AVVQIGTPEDILTNPADDYVARFVGEADVTKVLTAGSVMKRSEAVAVLGIDGPRTALRKM
RRNAIATLFVLDERHRLVGLITADDAARLAAEGVRELGSIVRRDIATVPPEAPATELISL
MADLPHPLAVVDERGRLAGVIVRGLLLGALAERGGVA