Protein Info for DVU2298 in Desulfovibrio vulgaris Hildenborough JW710

Name: opuBB
Annotation: glycine/betaine/L-proline ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 140 to 167 (28 residues), see Phobius details amino acids 207 to 235 (29 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 111 to 278 (168 residues), 103.2 bits, see alignment E=7.3e-34

Best Hits

Swiss-Prot: 48% identical to GBUB_LISM4: Glycine betaine/carnitine transport permease protein GbuB (gbuB) from Listeria monocytogenes serotype 1/2a (strain 10403S)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 100% identity to dvu:DVU2298)

Predicted SEED Role

"Glycine betaine ABC transport system, permease protein OpuAB" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729Q2 at UniProt or InterPro

Protein Sequence (283 amino acids)

>DVU2298 glycine/betaine/L-proline ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MMSVQIPRIPLGAWLEAFTDNMVEWCSGATRAFSTVAGNGIDMLESLLGSIPPWAFIPVV
ALLAWRATRKPGIGAFALLGFGLIWNLGLWEATMSTIALVLVATALAVVTGVPLGIAAAV
NVTVRKVLMPVLDLMQTMPAFVYLIPAIPFFGLGKVAAVFATVVFAMPPAIRFTCLGIRQ
VPDDLVECAEAFGTSRWQRLVKLELPLAAPTILAGVNQTIMLALSMVVIAAMIGARGLGG
EVWKAIQRLELGSGFEAGIGIVIVAICLDRVLQHIGRRSSVDR