Protein Info for DVU2292 in Desulfovibrio vulgaris Hildenborough JW710

Name: hypA
Annotation: hydrogenase nickel insertion protein HypA (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF01155: HypA" amino acids 1 to 112 (112 residues), 115.5 bits, see alignment E=6.6e-38 TIGR00100: hydrogenase nickel insertion protein HypA" amino acids 1 to 113 (113 residues), 100.4 bits, see alignment E=3.3e-33

Best Hits

Swiss-Prot: 100% identical to HYPA2_DESVH: Hydrogenase maturation factor HypA 2 (hypA2) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K04651, hydrogenase nickel incorporation protein HypA (inferred from 100% identity to dvl:Dvul_0963)

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation protein HypA" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729Q7 at UniProt or InterPro

Protein Sequence (120 amino acids)

>DVU2292 hydrogenase nickel insertion protein HypA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHEASIVAGIMRIVEEEAARHDVTRIARVRLRVGLLTGVEPRTLTACFELYSEGTVAEGA
SLDLETVPALGTCHACGATFDLHRRCFACPTCGNDDITLEGGRELTIAGLEVPQPEGATA